منبع پایان نامه درباره ACT، فیزیولوژی، پایگاه اطلاعات

ژنوتیپها نسبت به رقم زراعی CM 72 جو متحملتر بوده و تحمل به شوری به طور معنیداری وابسته به نسبت یون پتاسیم به یون سدیم بود. آنالیز همبستگی نشان داد که این دو ژن اصولاً انتقال یون سدیم و یون پتاسیم را تحت تنش شوری کنترل میکنند که این امر با آنالیز بعدی بیان ژن تأیید گردید. نتایج این مطالعه نشان داد که جوی وحشی تیبتان دارای آللهای الیت از این دو ژن میباشد که موجب تحمل به شوری میگردد. ریواندی و همکاران (2011) یک لوکوس کنترل کننده ذخیره یون سدیم، SOS3 که با HvNaX4 همولوگ بوده و روی بازوی بلند کروموزوم شماره یک جو قرار دارد، را به خوبی نقشهیابی کردند. ژن HvCBL4 جو یک همولوگ بسیار نزدیک به ژن متحمل به شوری SOS3 در آرابیدوپسیس است که هم زمان با HvNaX4 تفرق مییابد. آنها این لوکوس را روی کروموزوم شماره یک نقشهیابی کرده و دریافتند که لوکوس HvNaX4 میزان یون سدیم در شاخه را بین 12 و 59 درصد کاهش میدهد یا بسته به شرایط رشد هیدروپونیک و طیفی از انواع خاکها اصلاً این میزان را کاهش نمیدهد. این امر نشان دهنده تأثیر قوی محیط روی بیان ژن است. این محققان در بیان mRNAی لوکوس HvCBL4 بین والدینی که نقشهیابی شدند تفاوتی مشاهده نکردند. بنابراین آنها گزارش دادند که HvCBL4 یک ژن کاندیدا برای HvNaX4 است که باید بیشتر مورد بررسی و مطالعه قرار گیرد.
تحت تنش شوری غلظت یونهای پتاسیم و سدیم به شدت تغییر مییابد. تغییر غلظت این یونها تحت تأثیر ژنهای کنترل کننده این تنش و طی مسیرهای خاص بیوشیمیایی صورت می گیرد. یکی از راههای مطالعه مکانیسم این ژنها استفاده از موتاسیونهای مربوط میباشد. والیا و همکاران (2007) یک رقم متحمل به شوری در جو به نام گلدن پرامیس که حاصل موتاسیون القائی با پرتوتابی در رقم میتورپ میباشد را مورد مطالعه قرار دادند. گلدن پرامیس حاصل یک موتاسیون منفرد در لوکوس Ari-e روی کروموزوم شماره 5 جو است. این رقم یون سدیم کمتری نسبت به رقم والدینی خود در شاخهها ذخیره مینماید و هدف از این مطالعه تشریح اساس ژنتیکی و مکانیسم این تفاوت بوده است. نتایج این تحقیق نشان داد که این دو رقم از نظر ژنتیکی بسیار به هم نزدیک بوده اما ایزوژنیک نمیباشند و این به دلیل وجود سه بلوک هاپلوتیپ پلیمورف است. آنالیز ترینسکریپتوم نشان داد که واکنش این دو ژنوتیپ به تنش شوری کاملاً متفاوت است. همچنین، واکنش آنها نسبت به تنش شوری در بافت ریشه و شاخه بسیار متفاوت است. روش دیگر برای مطالعه این مکانیسمها استفاده از رادیو ردیابها می باشد. کودلا و همکاران (2010) عملکرد سیگنال دهی یون کلسیم در گیاهان را مطالعه نمودند. زیرا این یون در واکنشهای متعدد گیاه نسبت به محرکهای زنده و غیر زنده از جمله نور، دمای بالا یا پائین، شوری و خشکی نقش دارد. آنها توانستند اصول دقیق مکانیسمی را تشریح کنند که تحت آن تشخیص و تغییر جریان اختصاصی یون کلسیم در سلول به صورت واکنش متقابل پروتئین با پروتئین، فسفریلاسیون پروتئین و بیان ژن تعریف میگردد و به موجب آن ویژگی پاسخ به تحریک محیطی به طور هم زمان بررسی میشود. لیگابا و همکاران (2010) با مقایسه ارقامی از جو که از نظر حساسیت نسبت به شوری متفاوت بودند مکانیسمهای تحمل به شوری را در آنها مطالعه کردند. آنها واکنش تحمل به شوری را در سطوح فیزیولوژیکی و مولکولی در ارقام متحمل (K305) و حساس به شوری (1743) بررسی نمودند. این محققان گزارش دادند که آنالیز بیان ژن با استفاده از RT-PCR کمّی نشان داد که تعداد نسخههای ژنهای انتقال دهنده یون پتاسیم (HvAKT1 و HvHAK1)، H+-ATPase واکوئولی و پیروفسفاتاز غیرآلی (HvHVP1 و HvHVA/68) در شاخههای KK305 فراوانتر از 1743 بود. بیان انتقال دهندههای ژن HvHAK1 و /H+ Na+ (HvNHX1, HvNHX3 و HvHNX4) هنگام قرار گرفتن طولانی مدت در معرض شوری در ریشههای K305 بیش از ریشههای 1743 بود. نتایج این مطالعه پیشنهاد می کند که عملکرد بهتر رقم K305 در مقایسه با رقم 1743 در طول تنش شوری ممکن است با قابلیت بیشتر آن برای توقیف یون سدیم در زیر بخشهای سلولی و یا حفظ هموستازی یون پتاسیم مرتبط باشد.
امروزه آنالیز ترکیبی ژنهای مسئول تنشهای زنده در گیاهان همراه با بررسی بیوشیمیایی و فیزیولوژیکی آنها صورت میگیرد تا از این طریق درک بهتری از مکانیسم عمل این ژنها و شناسائی منابع مقاوم با استفاده از فرآیندهای متأثر از آنها انجام گیرد.
فصل دوم- مواد و روشها
2-1 فرضیات تحقیق
فرضیات این آزمایش شامل تشخیص آللها جدید و گروهبندی هاپلیوتیپی ژنوتیپهای مورد بررسی با استفاده از تنوع تک نوکلئوتیدی (SNP)، استفاده از تنوع هاپلوتیپی برای طبقهبندی اکوتیپها و کاهش هزینه، زمان و افزایش دقت نسبت به سایر روشهای مطالعه تنوع تک نوکلئوتیدی بوده است.
بخش عمده مراحل اجرائی این تحقیق در مرکز بین المللی تحقیقات کشاورزی در مناطق خشک (ICARDA) و بخشی دیگر در پژوهشکده بیوتکنولوژی کشاورزی کرج (ABRII) انجام گرفته است.
2-2 مواد گیاهی
در این تحقیق از 96 ژنوتیپ جو که در مناطق مختلف شور در جهان از جمله ایران کشت میگردند، به عنوان مواد گیاهی استفاده گردید که لیست اسامی و مشخصات آنها در بخش ضمیمه ذکر گردیده است. هدف از انتخاب این مواد بررسی تنوع ژنی مقاومت به شوری در ژنوتیپهای متعلق به مناطق متعدد جغرافیایی بوده است. زیرا طبق مطالعات قبلی، ژنوتیپهایی که در مناطق شور رشد و نمو مییابند دارای تنوع بیشتری از نظر دارا بودن ژنهای متحمل به شوری میباشند.
2-3 طراحی پرایمر
طراحی پرایمرها با استفاده از دادههای ژنومی جو که در پایگاه اطلاعاتی GeneBank موجود است، انجام گرفت. با توجه به اینکه این پرایمرها اختصاصی بوده و برای مطالعه عملکرد ژن طراحی شدند، از مناطق کد کننده ژن به عنوان توالیهای اولیه برای طراحی پرایمر استفاده گردید. ژن های مورد مطالعه در این تحقیق دو ژن متحمل به شوری CBL4و HKT1 بوده است. برای طراحی پرایمرها از نرم افزار آنلاین(http://frodo.wi.mit.edu/primer3/) Primer3 استفاده شد.
2-4 مدل ژنی ژنهای استفاده شده برای طراحی پرایمرها
مدل ژنی ژن CBL4 در شکل 2- 1 نشان داده شده است. همچنین توالی کامل مناطق کد کننده و غیر کد کننده این ژن در شکل 2-2 آورده شده است. مناطق کد کننده به صورت رنگی نمایش داده شدهاند.
شکل 2-1 منطقه کد کننده پروتئین ژن calcineurin B-like protein 4 (CBL4) در رقم Clipper جو
Hordeum vulgare subsp. vulgare cultivar Clipper calcineurin B-like protein 4 (CBL4) gene,complete cds
join(345..429,523..605,698..866,1011..1063,1169..1249,
1523..1635,1865..1937)
/gene=”CBL4″
/codon_start=1
/product=”calcineurin B-like protein 4″
/protein_id=”ADW08757.1″
/db_xref=”GI:320090215″
/translation=”MGCVSSSPGRSRRAPGYEDPAVLASQTSFTVNEVEALYELYKKL
SYSIFKDGLIHKEEFQLALFRTSKGPSLFADRVFDLFDLKRNGVIEFGEFVRSLSIFH
PKAPESDKAAFAFKLYDLRGTGYIEKEELRELVVALLDESDLCLSDSAVEEIVDNTFS
QADSNGDDRIDPKEWEEFVKKNPASLRNMSLPYLQDITTAFPSFVMHSEVDDYSGISK
شکل2- 2 توالی کامل ژن CBL4 و مشخصات منطقه کد کننده و توالی آمینو اسیدی در این ژن
مدل ژنی ژن HKT1 در شکل 2-3 نشان داده شده است. توالی مناطق کدکننده و غیرکدکننده ژن HKT1 در شکل 2-4 آمده است.
شکل 2-3 مدل ژنی ژن HKT1
Hordeum vulgare mRNA for high-affinity sodium transporter (HKT1 gene)
شکل 2- 4 توالی کامل ژن HKT1 و مشخصات منطقه کد کننده و توالی آمینو اسیدی در این ژن.
2-5 مشخصات پرایمرهای طراحی شده
برای هر یک از ژنهای CBL4 و HKT1 چهار پرایمر طراحی گردید که مشخصات آنها در جدول 2-1 ارائه شده است.
جدول 2-1 نام و توالی پرایمرهای طراحی شده برای ژنهای HKT1 و CBL4
شماره
نام
طول تخمینی قطعات تکثیری (bp)
توالی (5´ _ 3´)
1
CBL4-1
560
F: ATGGGTGGTTGTGTTTCTGTTAG R: AGAGGTCGAACACCCTGTCG
2
CBL4-2
630
F: CCTCAACTCATCTCATCTCATCTG
R: GATCTCCTCAACGGCGCTAT
3
CBL4-3
560
F: GAACTTCGGTTAACTGATTGCAT
R: CGGCAGATAAGTACTCACTGAAGA
4
CBL4-4
490
F: GAATGGCGATGACAGGATAGAC
R: GAGCTCCGGATTTTCGAGGT
5
HKT1-1
560
F: ACTCATATATAGCACCATGGGTTG
R: CCCTGTACATTTCTTGGGTGTAAT
6
HKT1-2
560
F: AAGAGTGAAGATCAGCTCAGTTCC
R: CCTAGGAAGCAGATTACCAAAATG
7
HKT1-3
560
F: ATTGTTCCCTCTCTTCCTTAGGTT
R: AGGTTGAGAAGTTGAGTGGATCAT
8
HKT1-4
490
F: AAGCCAAGAGAGGGTCGTTG
R: AGCGCAACATCCACAAACTATAAC
2-6 تهیه نمونه DNAی ژنومی
برای تهیه نمونه DNAی ژنومی، برگهای تازه گیاه از گیاهچههای 14 روزه گیاه جو جدا شده و به مدت 3 روز در دستگاه Dryfreez قرار داده شدند تا آب میان بافتی آنها کاملاً خشک شود. سپس نمونههای برگی با دستگاه گریندر کاملاً پودر شده و برای استخراج DNA آماده شدند. DNAی ژنومی از نمونه گیاهی هر ژنوتیپ طبق روش سقائی و همکاران (1984) با اندکی تغییرات استخراج گردید.
شکل 2- 5 گیاهچههای 14 روزه که برای تهیه نمونه برگی استفاده شدند.
2-7 تعیین کیفیت و کمَیَت نمونه های DNA
کیفیت و کمَیَت نمونه DNA های استخراج شده روی ژل آگارز 1% تعیین گردید. برای تعیین کیفیت DNA، یک میکرولیتر از DNAی ژنومی هر نمونه گیاهی همراه با 2 میکرولیتر بافر لود کننده روی ژل آگارز لود شد. برای تعیین کمَیَت DNA از DNAی لامبدا استفاده گردید. صد نانوگرم از آن در یک سمت ژل و 200 نانوگرم در سمت دیگر ژل همراه با نمونههای DNA استفاده گردید. سپس از روی تصاویر ژل و با توجه به وضعیت DNAی لامبدا روی آن، غلظت نمونههای DNA تخمین زده شد. شکل 2-8 تصویر ژل نمونههای DNAی استخراج شده را نشان میدهد. پس از تعیین غلظت استوکهای DNA، نمونههای رقیق شده DNA با غلظت 15 نانوگرم در میکرولیتر تهیه شد. برای رقیق کردن استوک DNA میتوان از آب استریل دوبار تقطیر و یا بافر 1/0 TE استفاده کرد اما برای توالییابی بهتر است از نمونه DNAهایی که با آب مقطر رقیق شدهاند استفاده نمود (زیرا بافر TE موجب ایجاد برخی اختلالات در دنیچره شدن دو رشته DNA در محصول PCR میگردد).
لامبدای 200 نانوگرم لامبدای 100 نانوگرم
-8
2-8 واکنش زنجیرهای پلیمراز برای تست پرایمرها
مناطق ژنومی محدود به توالی فوروارد و ریورس هر جفت پرایمر از طریق واکنش زنجیرهای پلیمراز (PCR) تکثیر شده و محصولات PCR روی ژل آگارز مورد ارزیابی قرار گرفتند. مقادیر مواد مورد نیاز برای انجام واکنش زنجیرهای پلیمراز در جدول 2-2 آورده شده است. این مواد از جمله بافر PCR، dNTP، MgCl2 و آنزیم DNA تک پلیمراز از شرکت فرمنتاز تهیه شدهاند. پرایمرهای مورد استفاده در این آزمایش از شرکت WMG تهیه گردیدند. برای تکثیر قطعات ژنومی مورد نظر ابتدا یک چرخه دمایی 94 درجه سانتی گراد به مدت 5 دقیقه، سپس 10 چرخه دمایی شامل، دمای 94 درجه سانتی گراد به مدت 30 ثانیه، 68 درجه سانتی گراد به مدت 30 ثانیه و 72 درجه سانتی گراد برای یک دقیقه اعمال گردید که در هر چرخه یک درجه دمای انلینگ (68 درجه) کاهش یافته و پس از چرخه دهم این دما به 58 درجه سانتی گراد تقلیل یافت.

مطلب مرتبط با این موضوع :  مقاله رایگان درموردالگوریتم، عضویت، پارامترهای

دیدگاهتان را بنویسید